Anti-PDZD3

Catalog Number: ATA-HPA077887
Article Name: Anti-PDZD3
Biozol Catalog Number: ATA-HPA077887
Supplier Catalog Number: HPA077887
Alternative Catalog Number: ATA-HPA077887-100,ATA-HPA077887-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ22756, IKEPP, PDZK2
Clonality: Polyclonal
Isotype: IgG
NCBI: 79849
UniProt: Q86UT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDV
Target: PDZD3
Antibody Type: Monoclonal Antibody
HPA077887-100ul