Anti-PLPPR2

Catalog Number: ATA-HPA077966
Article Name: Anti-PLPPR2
Biozol Catalog Number: ATA-HPA077966
Supplier Catalog Number: HPA077966
Alternative Catalog Number: ATA-HPA077966-100,ATA-HPA077966-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LPPR2, PRG-4
Clonality: Polyclonal
Concentration: 0,2
NCBI: 64748
UniProt: Q96GM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAA
Target: PLPPR2
HPA077966-100ul