Anti-BDP1

Catalog Number: ATA-HPA077984
Article Name: Anti-BDP1
Biozol Catalog Number: ATA-HPA077984
Supplier Catalog Number: HPA077984
Alternative Catalog Number: ATA-HPA077984-100,ATA-HPA077984-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR
Clonality: Polyclonal
Isotype: IgG
NCBI: 55814
UniProt: A6H8Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII
Target: BDP1
Antibody Type: Monoclonal Antibody
HPA077984-100ul