Anti-BDP1
Catalog Number:
ATA-HPA077984
| Article Name: |
Anti-BDP1 |
| Biozol Catalog Number: |
ATA-HPA077984 |
| Supplier Catalog Number: |
HPA077984 |
| Alternative Catalog Number: |
ATA-HPA077984-100,ATA-HPA077984-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
55814 |
| UniProt: |
A6H8Y1 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII |
| Target: |
BDP1 |
| Antibody Type: |
Monoclonal Antibody |
|
HPA077984-100ul |