Anti-IDS

Catalog Number: ATA-HPA078003
Article Name: Anti-IDS
Biozol Catalog Number: ATA-HPA078003
Supplier Catalog Number: HPA078003
Alternative Catalog Number: ATA-HPA078003-100,ATA-HPA078003-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SIDS
Clonality: Polyclonal
Isotype: IgG
NCBI: 3423
UniProt: P22304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVG
Target: IDS
Antibody Type: Monoclonal Antibody
HPA078003-100ul