Anti-POLM

Catalog Number: ATA-HPA078005
Article Name: Anti-POLM
Biozol Catalog Number: ATA-HPA078005
Supplier Catalog Number: HPA078005
Alternative Catalog Number: ATA-HPA078005-100,ATA-HPA078005-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Tdt-N
Clonality: Polyclonal
Concentration: 0,3
NCBI: 27434
UniProt: Q9NP87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
Target: POLM
HPA078005-100ul