Anti-POLD4

Catalog Number: ATA-HPA078008
Article Name: Anti-POLD4
Biozol Catalog Number: ATA-HPA078008
Supplier Catalog Number: HPA078008
Alternative Catalog Number: ATA-HPA078008-100,ATA-HPA078008-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: p12, POLDS
Clonality: Polyclonal
Isotype: IgG
NCBI: 57804
UniProt: Q9HCU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYP
Target: POLD4
Antibody Type: Monoclonal Antibody
HPA078008-100ul