Anti-MAP4K5

Catalog Number: ATA-HPA078030
Article Name: Anti-MAP4K5
Biozol Catalog Number: ATA-HPA078030
Supplier Catalog Number: HPA078030
Alternative Catalog Number: ATA-HPA078030-100,ATA-HPA078030-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GCKR, KHS, KHS1
Clonality: Polyclonal
Isotype: IgG
NCBI: 11183
UniProt: Q9Y4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI
Target: MAP4K5
Antibody Type: Monoclonal Antibody
HPA078030-100ul