Anti-POT1, Rabbit, Polyclonal

Catalog Number: ATA-HPA078046
Article Name: Anti-POT1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA078046
Supplier Catalog Number: HPA078046
Alternative Catalog Number: ATA-HPA078046-100,ATA-HPA078046-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Alternative Names: DKFZp586D211, hPot1
Rabbit Polyclonal POT1 Antibody against Human protection of telomeres 1. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.1
NCBI: 25913
UniProt: Q9NUX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: RLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTANQHSDV