Anti-GGN

Catalog Number: ATA-HPA078224
Article Name: Anti-GGN
Biozol Catalog Number: ATA-HPA078224
Supplier Catalog Number: HPA078224
Alternative Catalog Number: ATA-HPA078224-100,ATA-HPA078224-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ35713, MGC33369
Clonality: Polyclonal
Concentration: 0,1
NCBI: 199720
UniProt: Q86UU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SGAISYAEVLKQGPLPPGAARPLGEVSRGAQEAEGGDGDGEGCSGPPSAPASQARALPPPPYTTFPGSKPKFDWVSAPDGPERHFRFNGAG
Target: GGN
HPA078224-100ul