Anti-DLGAP1

Catalog Number: ATA-HPA078234
Article Name: Anti-DLGAP1
Biozol Catalog Number: ATA-HPA078234
Supplier Catalog Number: HPA078234
Alternative Catalog Number: ATA-HPA078234-100,ATA-HPA078234-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DAP-1, GKAP, SAPAP1
Clonality: Polyclonal
Concentration: 0,05
NCBI: 9229
UniProt: O14490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MKALTAAIEAANAQIHGPASQHMGNNTATVTTTTTIATVTTEDRKKDHFKKNRCLSIGIQVDDAEEPDKTGENKAPSKFQS
Target: DLGAP1
HPA078234-100ul