Anti-INO80B

Catalog Number: ATA-HPA078274
Article Name: Anti-INO80B
Biozol Catalog Number: ATA-HPA078274
Supplier Catalog Number: HPA078274
Alternative Catalog Number: ATA-HPA078274-100,ATA-HPA078274-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4
Clonality: Polyclonal
Concentration: 0,1
NCBI: 83444
UniProt: Q9C086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRA
Target: INO80B
HPA078274-100ul