Anti-NHLRC1

Catalog Number: ATA-HPA078292
Article Name: Anti-NHLRC1
Biozol Catalog Number: ATA-HPA078292
Supplier Catalog Number: HPA078292
Alternative Catalog Number: ATA-HPA078292-100,ATA-HPA078292-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA204B7.2, EPM2B
Clonality: Polyclonal
Concentration: 0,05
NCBI: 378884
UniProt: Q6VVB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTD
Target: NHLRC1
HPA078292-100ul