Anti-TMPRSS11A

Catalog Number: ATA-HPA078316
Article Name: Anti-TMPRSS11A
Biozol Catalog Number: ATA-HPA078316
Supplier Catalog Number: HPA078316
Alternative Catalog Number: ATA-HPA078316-100,ATA-HPA078316-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ECRG1
Clonality: Polyclonal
Isotype: IgG
NCBI: 339967
UniProt: Q6ZMR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR
Target: TMPRSS11A
Antibody Type: Monoclonal Antibody
HPA078316-100ul