Anti-RTEL1

Catalog Number: ATA-HPA078376
Article Name: Anti-RTEL1
Biozol Catalog Number: ATA-HPA078376
Supplier Catalog Number: HPA078376
Alternative Catalog Number: ATA-HPA078376-100,ATA-HPA078376-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Rabbit Polyclonal RTEL1 Antibody against Human regulator of telomere elongation helicase 1. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.1
NCBI: 51750
UniProt: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG
WB Image Caption 1