Anti-NUDT19

Catalog Number: ATA-HPA078387
Article Name: Anti-NUDT19
Biozol Catalog Number: ATA-HPA078387
Supplier Catalog Number: HPA078387
Alternative Catalog Number: ATA-HPA078387-100,ATA-HPA078387-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RP2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 390916
UniProt: A8MXV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QDPRHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVV
Target: NUDT19
HPA078387-100ul