Anti-SLC25A43

Catalog Number: ATA-HPA078530
Article Name: Anti-SLC25A43
Biozol Catalog Number: ATA-HPA078530
Supplier Catalog Number: HPA078530
Alternative Catalog Number: ATA-HPA078530-100,ATA-HPA078530-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 203427
UniProt: Q8WUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NGYILSPLSYKLTPGVDQSLQPQELRELKKFFK
Target: SLC25A43
Antibody Type: Monoclonal Antibody
HPA078530-100ul