Anti-LRRTM3

Catalog Number: ATA-HPA078598
Article Name: Anti-LRRTM3
Biozol Catalog Number: ATA-HPA078598
Supplier Catalog Number: HPA078598
Alternative Catalog Number: ATA-HPA078598-100,ATA-HPA078598-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 347731
UniProt: Q86VH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDL
Target: LRRTM3
Antibody Type: Monoclonal Antibody
HPA078598-100ul