Anti-CPZ

Catalog Number: ATA-HPA078608
Article Name: Anti-CPZ
Biozol Catalog Number: ATA-HPA078608
Supplier Catalog Number: HPA078608
Alternative Catalog Number: ATA-HPA078608-100,ATA-HPA078608-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 8532
UniProt: Q66K79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY
Target: CPZ
Antibody Type: Monoclonal Antibody
HPA078608-100ul