Anti-TXK

Catalog Number: ATA-HPA078636
Article Name: Anti-TXK
Biozol Catalog Number: ATA-HPA078636
Supplier Catalog Number: HPA078636
Alternative Catalog Number: ATA-HPA078636-100,ATA-HPA078636-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BTKL, PSCTK5, PTK4, RLK, TKL
Clonality: Polyclonal
Concentration: 0,2
NCBI: 7294
UniProt: P42681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLP
Target: TXK
HPA078636-100ul