Anti-TBR1

Catalog Number: ATA-HPA078644
Article Name: Anti-TBR1
Biozol Catalog Number: ATA-HPA078644
Supplier Catalog Number: HPA078644
Alternative Catalog Number: ATA-HPA078644-100,ATA-HPA078644-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TBR1
T-box, brain 1
Anti-TBR1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10716
UniProt: Q16650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TBR1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using Anti-TBR1 antibody. Corresponding TBR1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-TBR1 antibody HPA078644 (A) shows similar protein distribution across tissues to independent antibody HPA078657 (B).
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-TBR1 antibody HPA078644.
Immunohistochemical staining of human liver using Anti-TBR1 antibody HPA078644.
HPA078644-100ul
HPA078644-100ul
HPA078644-100ul