Anti-RPS25

Catalog Number: ATA-HPA078683
Article Name: Anti-RPS25
Biozol Catalog Number: ATA-HPA078683
Supplier Catalog Number: HPA078683
Alternative Catalog Number: ATA-HPA078683-100,ATA-HPA078683-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: S25
Clonality: Polyclonal
Isotype: IgG
NCBI: 6230
UniProt: P62851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKE
Target: RPS25
Antibody Type: Monoclonal Antibody
HPA078683-100ul