Anti-CERS2

Catalog Number: ATA-HPA078737
Article Name: Anti-CERS2
Biozol Catalog Number: ATA-HPA078737
Supplier Catalog Number: HPA078737
Alternative Catalog Number: ATA-HPA078737-100,ATA-HPA078737-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10243, LASS2, SP260
Clonality: Polyclonal
Isotype: IgG
NCBI: 29956
UniProt: Q96G23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
Target: CERS2
Antibody Type: Monoclonal Antibody
HPA078737-100ul