Anti-ARHGAP9

Catalog Number: ATA-HPA078822
Article Name: Anti-ARHGAP9
Biozol Catalog Number: ATA-HPA078822
Supplier Catalog Number: HPA078822
Alternative Catalog Number: ATA-HPA078822-100,ATA-HPA078822-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 10C, MGC1295
Clonality: Polyclonal
Isotype: IgG
NCBI: 64333
UniProt: Q9BRR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNW
Target: ARHGAP9
Antibody Type: Monoclonal Antibody
HPA078822-100ul