Anti-TMEM249

Catalog Number: ATA-HPA078901
Article Name: Anti-TMEM249
Biozol Catalog Number: ATA-HPA078901
Supplier Catalog Number: HPA078901
Alternative Catalog Number: ATA-HPA078901-100,ATA-HPA078901-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C8orfK29
Clonality: Polyclonal
Isotype: IgG
NCBI: 340393
UniProt: Q2WGJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MPKGRAGSLPTTSIGWRFQLWFLGLTCPERHLARRLKNNSFYPFVQQEPNVFVLEYYL
Target: TMEM249
Antibody Type: Monoclonal Antibody
HPA078901-100ul