Anti-DSG4

Catalog Number: ATA-HPA079244
Article Name: Anti-DSG4
Biozol Catalog Number: ATA-HPA079244
Supplier Catalog Number: HPA079244
Alternative Catalog Number: ATA-HPA079244-100,ATA-HPA079244-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CDHF13, LAH
Clonality: Polyclonal
Concentration: 0,1
NCBI: 147409
UniProt: Q86SJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ
Target: DSG4
HPA079244-100ul