Anti-FSCN2

Catalog Number: ATA-HPA079270
Article Name: Anti-FSCN2
Biozol Catalog Number: ATA-HPA079270
Supplier Catalog Number: HPA079270
Alternative Catalog Number: ATA-HPA079270-100,ATA-HPA079270-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RFSN, RP30
Clonality: Polyclonal
Isotype: IgG
NCBI: 25794
UniProt: O14926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HRYVSVRQGVNVSANQDDELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRG
Target: FSCN2
Antibody Type: Monoclonal Antibody
HPA079270-100ul