Anti-MAS1

Catalog Number: ATA-HPA079325
Article Name: Anti-MAS1
Biozol Catalog Number: ATA-HPA079325
Supplier Catalog Number: HPA079325
Alternative Catalog Number: ATA-HPA079325-100,ATA-HPA079325-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 4142
UniProt: P04201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV
Target: MAS1
Antibody Type: Monoclonal Antibody
HPA079325-100ul