Anti-DGCR8

Catalog Number: ATA-HPA079351
Article Name: Anti-DGCR8
Biozol Catalog Number: ATA-HPA079351
Supplier Catalog Number: HPA079351
Alternative Catalog Number: ATA-HPA079351-100,ATA-HPA079351-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C22orf12, DGCRK6, Gy1, pasha
Clonality: Polyclonal
Isotype: IgG
NCBI: 54487
UniProt: Q8WYQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDAL
Target: DGCR8
Antibody Type: Monoclonal Antibody
HPA079351-100ul