Anti-RAB44

Catalog Number: ATA-HPA079390
Article Name: Anti-RAB44
Biozol Catalog Number: ATA-HPA079390
Supplier Catalog Number: HPA079390
Alternative Catalog Number: ATA-HPA079390-100,ATA-HPA079390-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ431A14.3, RASD3, RASL13
Clonality: Polyclonal
Concentration: 0,05
NCBI: 401258
UniProt: Q7Z6P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GQERYHSMTRQLLRKADGVVLMYDITSQESFAHVRYWLDCLQDAGSDGVVILLLGNKMDCEEERQVSVEAGQQLAQ
Target: RAB44
HPA079390-100ul