Anti-C9orf153

Catalog Number: ATA-HPA079466
Article Name: Anti-C9orf153
Biozol Catalog Number: ATA-HPA079466
Supplier Catalog Number: HPA079466
Alternative Catalog Number: ATA-HPA079466-100,ATA-HPA079466-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA507D14.1
Clonality: Polyclonal
Isotype: IgG
NCBI: 389766
UniProt: Q5TBE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS
Target: C9orf153
Antibody Type: Monoclonal Antibody
HPA079466-100ul