Anti-TMEM247

Catalog Number: ATA-HPA079482
Article Name: Anti-TMEM247
Biozol Catalog Number: ATA-HPA079482
Supplier Catalog Number: HPA079482
Alternative Catalog Number: ATA-HPA079482-100,ATA-HPA079482-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 388946
UniProt: A6NEH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVLVFWMAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRAT
Target: TMEM247
Antibody Type: Monoclonal Antibody
HPA079482-100ul