Anti-PIFO

Catalog Number: ATA-HPA079487
Article Name: Anti-PIFO
Biozol Catalog Number: ATA-HPA079487
Supplier Catalog Number: HPA079487
Alternative Catalog Number: ATA-HPA079487-100,ATA-HPA079487-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf88, FLJ23853, pitchfork
Clonality: Polyclonal
Concentration: 0,05
NCBI: 128344
UniProt: Q8TCI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSPGAYNPEKKPPPKIAWPMKFGSPDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN
Target: PIFO
HPA079487-100ul