Anti-TMPRSS13

Catalog Number: ATA-HPA079555
Article Name: Anti-TMPRSS13
Biozol Catalog Number: ATA-HPA079555
Supplier Catalog Number: HPA079555
Alternative Catalog Number: ATA-HPA079555-100,ATA-HPA079555-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MSPL, MSPS, TMPRSS11
Clonality: Polyclonal
Concentration: 0,1
NCBI: 84000
UniProt: Q9BYE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDL
Target: TMPRSS13
HPA079555-100ul