Anti-INAVA

Catalog Number: ATA-HPA079622
Article Name: Anti-INAVA
Biozol Catalog Number: ATA-HPA079622
Supplier Catalog Number: HPA079622
Alternative Catalog Number: ATA-HPA079622-100,ATA-HPA079622-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf106, FLJ10901
Clonality: Polyclonal
Concentration: 0,1
NCBI: 55765
UniProt: Q3KP66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HHPKLLLPPGYFPAGRYVVVAESPLPPGEWELCRAVPGPAYEEEGTPLRYQRLVPSRSRIVRTPSLKDSPAGRGLSKAAVSEELKWWHER
Target: INAVA
HPA079622-100ul