Anti-PCSK1

Catalog Number: ATA-HPA079656
Article Name: Anti-PCSK1
Biozol Catalog Number: ATA-HPA079656
Supplier Catalog Number: HPA079656
Alternative Catalog Number: ATA-HPA079656-100,ATA-HPA079656-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NEC1, PC1, PC3, SPC3
Clonality: Polyclonal
Isotype: IgG
NCBI: 5122
UniProt: P29120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKS
Target: PCSK1
Antibody Type: Monoclonal Antibody
HPA079656-100ul