Anti-MAPK8IP1

Catalog Number: ATA-HPA079657
Article Name: Anti-MAPK8IP1
Biozol Catalog Number: ATA-HPA079657
Supplier Catalog Number: HPA079657
Alternative Catalog Number: ATA-HPA079657-100,ATA-HPA079657-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IB1, JIP-1, JIP1, PRKM8IP
Clonality: Polyclonal
Isotype: IgG
NCBI: 9479
UniProt: Q9UQF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRSTATQMAPPG
Target: MAPK8IP1
Antibody Type: Monoclonal Antibody
HPA079657-100ul