Anti-SYP

Catalog Number: ATA-HPA079659
Article Name: Anti-SYP
Biozol Catalog Number: ATA-HPA079659
Supplier Catalog Number: HPA079659
Alternative Catalog Number: ATA-HPA079659-100,ATA-HPA079659-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MRX96
Clonality: Polyclonal
Concentration: 0,05
NCBI: 6855
UniProt: P08247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Target: SYP
HPA079659-100ul