Anti-METTL3

Catalog Number: ATA-HPA079662
Article Name: Anti-METTL3
Biozol Catalog Number: ATA-HPA079662
Supplier Catalog Number: HPA079662
Alternative Catalog Number: ATA-HPA079662-100,ATA-HPA079662-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: M6A, MT-A70, Spo8
Clonality: Polyclonal
Concentration: 0,1
NCBI: 56339
UniProt: Q86U44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGII
Target: METTL3
HPA079662-100ul