Anti-PLAAT5

Catalog Number: ATA-HPA079686
Article Name: Anti-PLAAT5
Biozol Catalog Number: ATA-HPA079686
Supplier Catalog Number: HPA079686
Alternative Catalog Number: ATA-HPA079686-100,ATA-HPA079686-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HRASLS5, HRLP5, iNAT, PLAAT-5
Clonality: Polyclonal
Concentration: 0,1
NCBI: 117245
UniProt: Q96KN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPG
Target: PLAAT5
HPA079686-100ul