Anti-TEX26

Catalog Number: ATA-HPA079709
Article Name: Anti-TEX26
Biozol Catalog Number: ATA-HPA079709
Supplier Catalog Number: HPA079709
Alternative Catalog Number: ATA-HPA079709-100,ATA-HPA079709-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C13orf26, MGC40178
Clonality: Polyclonal
Isotype: IgG
NCBI: 122046
UniProt: Q8N6G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKE
Target: TEX26
Antibody Type: Monoclonal Antibody
HPA079709-100ul