Recombinant Glycine max Stress-induced protein SAM22 (PR-10), Unconjugated, Yeast

Catalog Number: BIM-RPC20254
Article Name: Recombinant Glycine max Stress-induced protein SAM22 (PR-10), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20254
Supplier Catalog Number: RPC20254
Alternative Catalog Number: BIM-RPC20254-20UG,BIM-RPC20254-100UG,BIM-RPC20254-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: PR-10, GLYMA_07G243500, Stress-induced protein SAM22, Pathogenesis-related protein 10, Starvation-associated message 22, allergen Gly m 4
Recombinant Glycine max Stress-induced protein SAM22 (PR-10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida). Target Name: PR-10. Target Synonyms: PR-10, GLYMA_07G243500, Stress-induced protein SAM22, Pathogenesis-related protein 10, Starvation-associated message 22, allergen Gly m 4. Accession Number: P26987. Expression Region: 1~158aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
Target: PR-10