Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2), Unconjugated, Yeast

Catalog Number: BIM-RPC20265
Article Name: Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20265
Supplier Catalog Number: RPC20265
Alternative Catalog Number: BIM-RPC20265-20UG,BIM-RPC20265-100UG,BIM-RPC20265-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Collapsin response mediator protein 2, CRMP-2N2A3Unc-33-like phosphoprotein 2, ULIP-2
Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DPYSL2. Target Synonyms: Collapsin response mediator protein 2, CRMP-2N2A3Unc-33-like phosphoprotein 2, ULIP-2. Accession Number: Q16555. Expression Region: 1~572aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 64.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 64.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKV
Target: DPYSL2