Recombinant Staphylococcus aureus Alpha-hemolysin (hly), Unconjugated, Yeast

Catalog Number: BIM-RPC20267
Article Name: Recombinant Staphylococcus aureus Alpha-hemolysin (hly), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20267
Supplier Catalog Number: RPC20267
Alternative Catalog Number: BIM-RPC20267-20UG,BIM-RPC20267-100UG,BIM-RPC20267-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Alpha-toxin
Recombinant Staphylococcus aureus Alpha-hemolysin (hly) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain NCTC 8325). Target Name: hly. Target Synonyms: Alpha-toxin. Accession Number: Q2G1X0. Expression Region: 27~319aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 35.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD
Target: hly