Recombinant Dog Minor allergen Can f 2, Unconjugated, E. coli

Catalog Number: BIM-RPC20281
Article Name: Recombinant Dog Minor allergen Can f 2, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20281
Supplier Catalog Number: RPC20281
Alternative Catalog Number: BIM-RPC20281-20UG,BIM-RPC20281-100UG,BIM-RPC20281-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Canine
Conjugation: Unconjugated
Alternative Names: Allergen Dog 2Allergen: Can f 2
Recombinant Dog Minor allergen Can f 2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris, Canine). Target Name: Dog Minor allergen Can f 2. Target Synonyms: Allergen Dog 2Allergen: Can f 2. Accession Number: O18874. Expression Region: 19~180aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 34.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
Target: Dog Minor allergen Can f 2