Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20312
Article Name: Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20312
Supplier Catalog Number: RPC20312
Alternative Catalog Number: BIM-RPC20312-20UG,BIM-RPC20312-100UG,BIM-RPC20312-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Clinically amyopathic dermatomyositis autoantigen 140 kDa
Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IFIH1. Target Synonyms: Clinically amyopathic dermatomyositis autoantigen 140 kDa. Accession Number: Q9BYX4. Expression Region: 700~1025aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 41.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADY
Target: IFIH1