Recombinant Pseudomonas aeruginosa Elastase (lasB), Unconjugated, E. coli

Catalog Number: BIM-RPC20314
Article Name: Recombinant Pseudomonas aeruginosa Elastase (lasB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20314
Supplier Catalog Number: RPC20314
Alternative Catalog Number: BIM-RPC20314-20UG,BIM-RPC20314-100UG,BIM-RPC20314-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Neutral metalloproteinasePAEPseudolysinCleaved into the following chain:Pro-elastase
Recombinant Pseudomonas aeruginosa Elastase (lasB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228). Target Name: lasB. Target Synonyms: Neutral metalloproteinasePAEPseudolysinCleaved into the following chain:Pro-elastase. Accession Number: P14756. Expression Region: 198~498aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDAN
Target: lasB