Recombinant Marmota monax Interferon gamma (IFNG), Unconjugated, Yeast

Catalog Number: BIM-RPC20316
Article Name: Recombinant Marmota monax Interferon gamma (IFNG), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20316
Supplier Catalog Number: RPC20316
Alternative Catalog Number: BIM-RPC20316-20UG,BIM-RPC20316-100UG,BIM-RPC20316-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rodent
Conjugation: Unconjugated
Alternative Names: IFN-gamma
Recombinant Marmota monax Interferon gamma (IFNG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Marmota monax (Woodchuck). Target Name: IFNG. Target Synonyms: IFN-gamma. Accession Number: O35735. Expression Region: 24~166aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK
Target: IFNG