Recombinant Influenza A virus Hemagglutinin (HA), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20327
Article Name: Recombinant Influenza A virus Hemagglutinin (HA), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20327
Supplier Catalog Number: RPC20327
Alternative Catalog Number: BIM-RPC20327-20UG,BIM-RPC20327-100UG,BIM-RPC20327-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Cleaved into the following 2 chains:Hemagglutinin HA1 chainHemagglutinin HA2 chain
Recombinant Influenza A virus Hemagglutinin (HA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/Hickox/1940 H1N1). Target Name: HA. Target Synonyms: Cleaved into the following 2 chains:Hemagglutinin HA1 chainHemagglutinin HA2 chain. Accession Number: Q0HD60. Expression Region: 18~343aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 52.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 52.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPLQLGKCNIAGWILGNPECESLLSKRSWSYIAETPNSENGTCYPGDFADYEELREQLSSVSSFERFEIFPKERSWPNHNINIGVTAACSHAGKSSFYKNLLWLTEKDGSYPNLNKSYVNKKEKEVLVLWGVHHPSNIENQKTLYRKENAYVSVVSSNYNRRFTPEIAERPKVRGQAGRMNYYWTLLEPGDTIIFEANGNLIAPWYAF
Target: HA