Recombinant Human Steroid 21-hydroxylase (CYP21A2), Unconjugated, Yeast

Catalog Number: BIM-RPC20335
Article Name: Recombinant Human Steroid 21-hydroxylase (CYP21A2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20335
Supplier Catalog Number: RPC20335
Alternative Catalog Number: BIM-RPC20335-20UG,BIM-RPC20335-100UG,BIM-RPC20335-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 21-OHaseCytochrome P-450c21Cytochrome P450 21Cytochrome P450 XXICytochrome P450-C21Cytochrome P450-C21B
Recombinant Human Steroid 21-hydroxylase (CYP21A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CYP21A2. Target Synonyms: 21-OHaseCytochrome P-450c21Cytochrome P450 21Cytochrome P450 XXICytochrome P450-C21Cytochrome P450-C21B. Accession Number: P08686. Expression Region: 1~494aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 57.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 57.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MLLLGLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWRD
Target: CYP21A2