Recombinant Human RuvB-like 2 (RUVBL2), Unconjugated, E. coli

Catalog Number: BIM-RPC20342
Article Name: Recombinant Human RuvB-like 2 (RUVBL2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20342
Supplier Catalog Number: RPC20342
Alternative Catalog Number: BIM-RPC20342-20UG,BIM-RPC20342-100UG,BIM-RPC20342-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 48 kDa TATA box-binding protein-interacting protein48 kDa TBP-interacting protein51 kDa erythrocyte cytosolic proteinECP-51INO80 complex subunit JRepressing pontin 52Reptin 52TIP49bTIP60-associated protein 54-betaTAP54-beta
Recombinant Human RuvB-like 2 (RUVBL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RUVBL2. Target Synonyms: 48 kDa TATA box-binding protein-interacting protein48 kDa TBP-interacting protein51 kDa erythrocyte cytosolic proteinECP-51INO80 complex subunit JRepressing pontin 52Reptin 52TIP49bTIP60-associated protein 54-betaTAP54-beta. Accession Number: Q9Y230. Expression Region: 2~463aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 67kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 67kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG
Target: RUVBL2